Пінка для вмивання Revilab evolution

Артикул: 7310300
322,00 грн 0,00 грн

Всі ми знаємо, що шкіру обличчя необхідно очищати щодня, адже за цілий день на обличчі осідає пил, а в сукупності з шкірним жиром такий альянс може стати причиною виникнення вугрів і висипу. Досі побутує думка, що для вмивання достатньо звичайного мила, і шкіра відразу стане чистою, свіжою і підтягнутою. Але у більшості ж випадків замість прекрасної шкіри можна отримати:

  • сухість;
  • стягнення;
  • почервоніння;
  • нові висипання;
  • лущення.

Щоб цього уникнути і при цьому забезпечити шкірі належний догляд, було розроблено більш легке по своїй текстурі очищають засіб – унікальна інноваційна пінка Revilab. Вона більш м'яка, утримує ліпідний бар'єр, на відміну від більш агресивних гелів і мила. Але самим головним її перевагою є збереження вологи і м'якості шкіри. Також пінка краще всього підходить для зняття макіяжу. Її легко можна використовувати кілька разів протягом дня, при цьому не пересушує шкіру.

Пінка для вмивання з серії Revilab evolution м'яко і ніжно впливає на шкіру. Вона дбайливо і ефективно очищає від забруднень, макіяжу і надлишків шкірного жиру. Не дратує,не сушить шкіру і не залишає жирного блиску. Пінка забезпечує тривале відчуття свіжості і комфорту.

Склад: Aqua, Cocamidopropyl Betaine, Glycerin, Poloxamer 184, Polyquaternium-7, Sodium Lauroyl Sarcosinate, Betaine, PEG-40 Hydrogenated Castor Oil, Propylene Glycol, Coco-Glucoside, Squalane, Sodium Surfactin, Phenoxyethanol, Ethylhexylglycerin, Hydrolyzed Wheat Protein, Sodium Methylcocoyl Taurate, Panthenol, Hydrolyzed Milk Protein, Parfum

Властивості активних компонентів: Опис властивостей знаходиться у Вкладці «Характеристики»

Легка, майже невагома, наповнена бульбашками повітря пінка, як хмарка огортає вашу шкіру, видаляючи забруднення з її поверхні. Вона містить речовини, що володіють доглядають, протизапальну і загоюючим ефектом разом з м'яким очищенням.

Але, щоб пінка могла виконувати свою роботу якісно, слід дотримуватися рекомендацій по її використанню.

Умивайте обличчя пінкою два рази в день – вранці і ввечері.
➤ Ранкове очищення сприяє видаленню надлишок шкірного сала і відмерлих клітин тканини.
➤ Вечірнє очищення бореться з забрудненнями, що надає позитивний вплив на оновлення і відновлення дерми протягом ночі.

Спосіб застосування:

  1. Натисніть 1-2 рази на дозатор, видавивши невелику кількість засобу – цього буде достатньо.
  2. Круговими рухами подушечками пальців нанесіть пінку на вологу шкіру обличчя і помасажуйте легкими рухами. Починайте з чола, потім просувайтеся до щік, носа, підборіддя і шиї. Зупиняйтеся на кілька секунд в тих місцях, які схильні до більшого забруднення, виділення шкірного сала і запалень: крила носа, щоки.
  3. Продовжуйте масажувати обличчя протягом хвилини, дозволяючи засобу проникати в глибокі шари шкіри.
  4. Промийте обличчя теплою водою, ретельно видаляючи залишки піни.
Не струшуйте флакон, це може позначитися на щільності піни.

Форма випуску: 160 мл

Очищення – обов'язковий етап у догляді за особою, і якщо вдається правильно підібрати засіб, то в результаті можна отримати гладку ніжну шкіру

  • Форма випуску: i
                                            object(stdClass)#1745 (14) {
      string(3) "122"
      string(3) "119"
      string(1) "0"
      string(16) "Упаковка"
      string(27) "Объём упаковки"
      string(8) "upakovka"
      string(1) "1"
      string(0) ""
      string(1) "1"
      string(25) "Форма випуску"
      string(26) "Об'єм упаковки"
      array(1) {
        object(stdClass)#1008 (7) {
          string(4) "1176"
          string(3) "122"
          string(3) "912"
          string(1) "1"
          string(8) "160 мл"
          string(7) "160spml"
      string(8) "160 мл"
    160 мл
  • Sodium Lauroyl Sarcosinate:
                                            object(stdClass)#1744 (14) {
      string(3) "395"
      string(3) "402"
      string(1) "0"
      string(0) ""
      string(0) ""
      string(28) "sodiumsplauroylspsarcosinate"
      string(0) ""
      string(1) "1"
      string(26) "Sodium Lauroyl Sarcosinate"
      string(0) ""
      array(1) {
        object(stdClass)#853 (7) {
          string(4) "1177"
          string(3) "395"
          string(4) "1177"
          string(1) "0"
          string(327) "Делікатний очищаючий агент, зменшує подразнюючу дію інших поверхнево-активних речовин на шкіру. Він не містить консервантів, сприяє відчуттю тривалого комфорту і м'якості шкіри."
          string(240) "delikatnyjspochischayuschijspagentcspumenshayuschijsprazdrazhayuscheespdejstviespdrugihsppoverhnostnomaktivnyhspveschestvspnaspkozhudsponspnespsoderzhitspkonservantovcspsposobstvuetsposchuscheniyuspdlitelnogospkomfortaspispmyagkostispkozhid"
      string(327) "Делікатний очищаючий агент, зменшує подразнюючу дію інших поверхнево-активних речовин на шкіру. Він не містить консервантів, сприяє відчуттю тривалого комфорту і м'якості шкіри."
    Делікатний очищаючий агент, зменшує подразнюючу дію інших поверхнево-активних речовин на шкіру. Він не містить консервантів, сприяє відчуттю тривалого комфорту і м'якості шкіри.
  • Sodium Surfactin:
                                            object(stdClass)#1743 (14) {
      string(3) "396"
      string(3) "403"
      string(1) "0"
      string(0) ""
      string(0) ""
      string(17) "sodiumspsurfactin"
      string(0) ""
      string(1) "1"
      string(16) "Sodium Surfactin"
      string(0) ""
      array(1) {
        object(stdClass)#1504 (7) {
          string(4) "1178"
          string(3) "396"
          string(4) "1178"
          string(1) "0"
          string(359) "Ліпопептід, який відповідає за правильне відновлення шкірного бар'єру. Він сприяє профілактиці акне за рахунок пригнічення росту бактерій Propionibacterium acnes і зберігає природний гідроліпідний баланс."
          string(239) "lipopeptidcspkotoryjspotvechaetspzasppravilnoespvosstanovleniespkozhnogospbareradsponspsposobstvuetspprofilaktikespaknespzaspschetsppodavleniyasprostaspbakterijsppropionibacteriumspacnesspispsohranyaetspestestvennyjspgidrolipidnyjspbalansd"
      string(359) "Ліпопептід, який відповідає за правильне відновлення шкірного бар'єру. Він сприяє профілактиці акне за рахунок пригнічення росту бактерій Propionibacterium acnes і зберігає природний гідроліпідний баланс."
    Ліпопептід, який відповідає за правильне відновлення шкірного бар'єру. Він сприяє профілактиці акне за рахунок пригнічення росту бактерій Propionibacterium acnes і зберігає природний гідроліпідний баланс.
  • Сквалан:
                                            object(stdClass)#1741 (14) {
      string(3) "397"
      string(3) "404"
      string(1) "0"
      string(0) ""
      string(0) ""
      string(7) "skvalan"
      string(0) ""
      string(1) "1"
      string(14) "Сквалан"
      string(0) ""
      array(1) {
        object(stdClass)#1719 (7) {
          string(4) "1179"
          string(3) "397"
          string(4) "1179"
          string(1) "0"
          string(245) "Підвищує імунітет у клітинах, володіє протигрибковою дією, допомагає антитілам, які борються з бактеріями, інтенсивніше вироблятися."
          string(162) "povyshaetspimmunitetspvspkletkahcspobladaetspprotivogribkovymspdejstviemcsppomogaetspantitelamcspkotoryespboryutsyaspsspbakteriyamicspintensivnejspvyrabatyvatsyad"
      string(245) "Підвищує імунітет у клітинах, володіє протигрибковою дією, допомагає антитілам, які борються з бактеріями, інтенсивніше вироблятися."
    Підвищує імунітет у клітинах, володіє протигрибковою дією, допомагає антитілам, які борються з бактеріями, інтенсивніше вироблятися.
  • Протеїни пшениці:
                                            object(stdClass)#1518 (14) {
      string(3) "398"
      string(3) "405"
      string(1) "0"
      string(0) ""
      string(0) ""
      string(19) "proteinysppshenitsy"
      string(0) ""
      string(1) "1"
      string(31) "Протеїни пшениці"
      string(0) ""
      array(1) {
        object(stdClass)#1718 (7) {
          string(4) "1180"
          string(3) "398"
          string(4) "1180"
          string(1) "0"
          string(176) "Багаті антиоксидантами і вітамінами, що дозволяє їм значно пом'якшувати верхній шар епідермісу."
          string(113) "bogatyspantioksidantamispispvitaminamicspchtosppozvolyaetspimspznachitelnospsmyagchatspverhnijspslojspepidermisad"
      string(176) "Багаті антиоксидантами і вітамінами, що дозволяє їм значно пом'якшувати верхній шар епідермісу."
    Багаті антиоксидантами і вітамінами, що дозволяє їм значно пом'якшувати верхній шар епідермісу.
  • Молочний білок:
                                            object(stdClass)#1513 (14) {
      string(3) "399"
      string(3) "406"
      string(1) "0"
      string(0) ""
      string(0) ""
      string(16) "molochnyjspbelok"
      string(0) ""
      string(1) "1"
      string(27) "Молочний білок"
      string(0) ""
      array(1) {
        object(stdClass)#1652 (7) {
          string(4) "1181"
          string(3) "399"
          string(4) "1181"
          string(1) "0"
          string(194) "Ефективно захищає шкіру, зберігає її зволоженою і зменшує алергічні інфекції, такі як висип і темні плями."
          string(141) "effektivnospzaschischaetspkozhucspsohranyaetspeespuvlazhnennojspispumenshaetspallergicheskiespinfektsiicsptakiespkakspsypspisptemnyesppyatnad"
      string(194) "Ефективно захищає шкіру, зберігає її зволоженою і зменшує алергічні інфекції, такі як висип і темні плями."
    Ефективно захищає шкіру, зберігає її зволоженою і зменшує алергічні інфекції, такі як висип і темні плями.
Сортувати за:
Поки немає відгуків


Клінічні результати
Допомога у виборі Віофтану
Допомога у виборі Віоргонів
100% гарантія якості
100% гарантія якості
14 днів на повернення товару
14 днів на повернення товару
Доставка по всій країні
Доставка по всій країні
Самовивіз з магазину
Самовивіз з магазину