Характеристики Пенка для умывания

Бренд:
Peptides
Артикул: 7310300
322,00 грн 0,00 грн
+
Описание

Все мы знаем, что кожу лица необходимо очищать ежедневно, ведь за целый день на лице оседает пыль, а в совокупности с кожным жиром такой альянс может стать причиной возникновения угрей и сыпи. До сих пор бытует мнение, что для умывания достаточно обычного мыла, и кожа сразу станет свежей, чистой и подтянутой. Но в большинстве же случаев вместо прекрасной кожи можно получить:

  • сухость;
  • стянутость;
  • покраснения;
  • новые высыпания;
  • шелушение.

Чтобы этого избежать и при этом обеспечить коже должный уход, было разработано более легкое по своей текстуре очищающие средство – уникальная инновационная пенка Revilab. Она более мягкая, удерживает липидный барьер, в отличие от более агрессивных гелей и мыла. Но самым главным ее преимуществом является сохранение влаги и мягкости кожи. Также пенка лучше всего подходит для снятия макияжа. Ее легко можно использовать несколько раз в течение дня, при этом не пересушивая кожу.

Пенка для умывания из серии Revilab evolution мягко и нежно воздействует на кожу. Она бережно и эффективно очищает от загрязнений, макияжа и излишков кожного жира. Не раздражает, не сушит кожу и не оставляет жирного блеска. Пенка обеспечивает длительное ощущение свежести и комфорта.

Состав: Aqua, Cocamidopropyl Betaine, Glycerin, Poloxamer 184, Polyquaternium-7, Sodium Lauroyl Sarcosinate, Betaine, PEG-40 Hydrogenated Castor Oil, Propylene Glycol, Coco-Glucoside, Squalane, Sodium Surfactin, Phenoxyethanol, Ethylhexylglycerin, Hydrolyzed Wheat Protein, Sodium Methylcocoyl Taurate, Panthenol, Hydrolyzed Milk Protein, Parfum

Свойства активных компонентов: Описание свойств находится во Вкладке «Характеристики»

Легкая, почти невесомая, наполненная пузырьками воздуха пенка, как облачко окутывает вашу кожу, удаляя загрязнения с ее поверхности. Она содержит вещества, обладающие ухаживающим, противовоспалительным и заживляющим эффектом вместе с мягким очищением.

Но, чтобы пенка могла выполнять свою работу качественно, следует соблюдать рекомендации по ее использованию.

Умывайте лицо пенкой два раза в день – утром и вечером.
➤ Утреннее очищение способствует удалению излишек кожного сала и омертвевших клеток ткани.
➤ Вечернее очищение борется с загрязнениями, что оказывает положительное влияние на обновлении и восстановлении дермы в течение ночи.

Способ применения:

  1. Нажмите 1-2 раза на дозатор, выдавив небольшое количество средства – этого будет достаточно.
  2. Круговыми движениями подушечками пальцев нанесите пенку на влажную кожу лица и помассируйте легкими движениями. Начинайте со лба, затем продвигайтесь к щекам, носу, подбородку и к шее. Останавливайтесь на несколько секунд в тех местах, которые подвержены большему загрязнению, выделению кожного сала и воспалениям: крылья носа, щёки.
  3. Продолжайте массировать лицо в течение минуты, позволяя средству проникать в глубокие слои кожи.
  4. Промойте лицо тёплой водой, тщательно удаляя остатки пены.
Не встряхивайте флакон, это может сказаться на плотности пены.

Форма выпуска: 160 мл

Очищение – обязательный этап в уходе за лицом, и если удается правильно подобрать средство, то в результате можно получить гладкую нежную кожу

Характеристики
  • Форма выпуска: i
                                            object(stdClass)#1745 (14) {
      ["id"]=>
      string(3) "122"
      ["position"]=>
      string(3) "119"
      ["in_filter"]=>
      string(1) "0"
      ["auto_name_id"]=>
      string(16) "Упаковка"
      ["auto_value_id"]=>
      string(27) "Объём упаковки"
      ["url"]=>
      string(8) "upakovka"
      ["url_in_product"]=>
      string(1) "1"
      ["to_index_new_value"]=>
      NULL
      ["external_id"]=>
      string(0) ""
      ["visible"]=>
      string(1) "1"
      ["name"]=>
      string(25) "Форма выпуска"
      ["description"]=>
      string(27) "Объём упаковки"
      ["values"]=>
      array(1) {
        [0]=>
        object(stdClass)#1008 (7) {
          ["id"]=>
          string(4) "1176"
          ["feature_id"]=>
          string(3) "122"
          ["position"]=>
          string(3) "912"
          ["to_index"]=>
          string(1) "1"
          ["external_id"]=>
          NULL
          ["value"]=>
          string(8) "160 мл"
          ["translit"]=>
          string(7) "160spml"
        }
      }
      ["stingify_values"]=>
      string(8) "160 мл"
    }
    
                                        
    160 мл
  • Sodium Lauroyl Sarcosinate:
                                            object(stdClass)#1744 (14) {
      ["id"]=>
      string(3) "395"
      ["position"]=>
      string(3) "402"
      ["in_filter"]=>
      string(1) "0"
      ["auto_name_id"]=>
      string(0) ""
      ["auto_value_id"]=>
      string(0) ""
      ["url"]=>
      string(28) "sodiumsplauroylspsarcosinate"
      ["url_in_product"]=>
      NULL
      ["to_index_new_value"]=>
      NULL
      ["external_id"]=>
      string(0) ""
      ["visible"]=>
      string(1) "1"
      ["name"]=>
      string(26) "Sodium Lauroyl Sarcosinate"
      ["description"]=>
      NULL
      ["values"]=>
      array(1) {
        [0]=>
        object(stdClass)#853 (7) {
          ["id"]=>
          string(4) "1177"
          ["feature_id"]=>
          string(3) "395"
          ["position"]=>
          string(4) "1177"
          ["to_index"]=>
          string(1) "0"
          ["external_id"]=>
          NULL
          ["value"]=>
          string(366) "Деликатный очищающий агент, уменьшающий раздражающее действие других поверхностно-активных веществ на кожу. Он не содержит консервантов, способствует ощущению длительного комфорта и мягкости кожи."
          ["translit"]=>
          string(240) "delikatnyjspochischayuschijspagentcspumenshayuschijsprazdrazhayuscheespdejstviespdrugihsppoverhnostnomaktivnyhspveschestvspnaspkozhudsponspnespsoderzhitspkonservantovcspsposobstvuetsposchuscheniyuspdlitelnogospkomfortaspispmyagkostispkozhid"
        }
      }
      ["stingify_values"]=>
      string(366) "Деликатный очищающий агент, уменьшающий раздражающее действие других поверхностно-активных веществ на кожу. Он не содержит консервантов, способствует ощущению длительного комфорта и мягкости кожи."
    }
    
                                        
    Деликатный очищающий агент, уменьшающий раздражающее действие других поверхностно-активных веществ на кожу. Он не содержит консервантов, способствует ощущению длительного комфорта и мягкости кожи.
  • Sodium Surfactin:
                                            object(stdClass)#1743 (14) {
      ["id"]=>
      string(3) "396"
      ["position"]=>
      string(3) "403"
      ["in_filter"]=>
      string(1) "0"
      ["auto_name_id"]=>
      string(0) ""
      ["auto_value_id"]=>
      string(0) ""
      ["url"]=>
      string(17) "sodiumspsurfactin"
      ["url_in_product"]=>
      NULL
      ["to_index_new_value"]=>
      NULL
      ["external_id"]=>
      string(0) ""
      ["visible"]=>
      string(1) "1"
      ["name"]=>
      string(16) "Sodium Surfactin"
      ["description"]=>
      NULL
      ["values"]=>
      array(1) {
        [0]=>
        object(stdClass)#1504 (7) {
          ["id"]=>
          string(4) "1178"
          ["feature_id"]=>
          string(3) "396"
          ["position"]=>
          string(4) "1178"
          ["to_index"]=>
          string(1) "0"
          ["external_id"]=>
          NULL
          ["value"]=>
          string(378) "Липопептид, который отвечает за правильное восстановление кожного барьера. Он способствует профилактике акне за счет подавления роста бактерий Propionibacterium acnes и сохраняет естественный гидролипидный баланс."
          ["translit"]=>
          string(239) "lipopeptidcspkotoryjspotvechaetspzasppravilnoespvosstanovleniespkozhnogospbareradsponspsposobstvuetspprofilaktikespaknespzaspschetsppodavleniyasprostaspbakterijsppropionibacteriumspacnesspispsohranyaetspestestvennyjspgidrolipidnyjspbalansd"
        }
      }
      ["stingify_values"]=>
      string(378) "Липопептид, который отвечает за правильное восстановление кожного барьера. Он способствует профилактике акне за счет подавления роста бактерий Propionibacterium acnes и сохраняет естественный гидролипидный баланс."
    }
    
                                        
    Липопептид, который отвечает за правильное восстановление кожного барьера. Он способствует профилактике акне за счет подавления роста бактерий Propionibacterium acnes и сохраняет естественный гидролипидный баланс.
  • Сквалан:
                                            object(stdClass)#1741 (14) {
      ["id"]=>
      string(3) "397"
      ["position"]=>
      string(3) "404"
      ["in_filter"]=>
      string(1) "0"
      ["auto_name_id"]=>
      string(0) ""
      ["auto_value_id"]=>
      string(0) ""
      ["url"]=>
      string(7) "skvalan"
      ["url_in_product"]=>
      NULL
      ["to_index_new_value"]=>
      NULL
      ["external_id"]=>
      string(0) ""
      ["visible"]=>
      string(1) "1"
      ["name"]=>
      string(14) "Сквалан"
      ["description"]=>
      NULL
      ["values"]=>
      array(1) {
        [0]=>
        object(stdClass)#1719 (7) {
          ["id"]=>
          string(4) "1179"
          ["feature_id"]=>
          string(3) "397"
          ["position"]=>
          string(4) "1179"
          ["to_index"]=>
          string(1) "0"
          ["external_id"]=>
          NULL
          ["value"]=>
          string(269) "Повышает иммунитет в клетках, обладает противогрибковым действием, помогает антителам, которые борются с бактериями, интенсивней вырабатываться."
          ["translit"]=>
          string(162) "povyshaetspimmunitetspvspkletkahcspobladaetspprotivogribkovymspdejstviemcsppomogaetspantitelamcspkotoryespboryutsyaspsspbakteriyamicspintensivnejspvyrabatyvatsyad"
        }
      }
      ["stingify_values"]=>
      string(269) "Повышает иммунитет в клетках, обладает противогрибковым действием, помогает антителам, которые борются с бактериями, интенсивней вырабатываться."
    }
    
                                        
    Повышает иммунитет в клетках, обладает противогрибковым действием, помогает антителам, которые борются с бактериями, интенсивней вырабатываться.
  • Протеины пшеницы:
                                            object(stdClass)#1518 (14) {
      ["id"]=>
      string(3) "398"
      ["position"]=>
      string(3) "405"
      ["in_filter"]=>
      string(1) "0"
      ["auto_name_id"]=>
      string(0) ""
      ["auto_value_id"]=>
      string(0) ""
      ["url"]=>
      string(19) "proteinysppshenitsy"
      ["url_in_product"]=>
      NULL
      ["to_index_new_value"]=>
      NULL
      ["external_id"]=>
      string(0) ""
      ["visible"]=>
      string(1) "1"
      ["name"]=>
      string(31) "Протеины пшеницы"
      ["description"]=>
      NULL
      ["values"]=>
      array(1) {
        [0]=>
        object(stdClass)#1718 (7) {
          ["id"]=>
          string(4) "1180"
          ["feature_id"]=>
          string(3) "398"
          ["position"]=>
          string(4) "1180"
          ["to_index"]=>
          string(1) "0"
          ["external_id"]=>
          NULL
          ["value"]=>
          string(185) "Богаты антиоксидантами и витаминами, что позволяет им значительно смягчать верхний слой эпидермиса."
          ["translit"]=>
          string(113) "bogatyspantioksidantamispispvitaminamicspchtosppozvolyaetspimspznachitelnospsmyagchatspverhnijspslojspepidermisad"
        }
      }
      ["stingify_values"]=>
      string(185) "Богаты антиоксидантами и витаминами, что позволяет им значительно смягчать верхний слой эпидермиса."
    }
    
                                        
    Богаты антиоксидантами и витаминами, что позволяет им значительно смягчать верхний слой эпидермиса.
  • Молочный белок:
                                            object(stdClass)#1513 (14) {
      ["id"]=>
      string(3) "399"
      ["position"]=>
      string(3) "406"
      ["in_filter"]=>
      string(1) "0"
      ["auto_name_id"]=>
      string(0) ""
      ["auto_value_id"]=>
      string(0) ""
      ["url"]=>
      string(16) "molochnyjspbelok"
      ["url_in_product"]=>
      NULL
      ["to_index_new_value"]=>
      NULL
      ["external_id"]=>
      string(0) ""
      ["visible"]=>
      string(1) "1"
      ["name"]=>
      string(27) "Молочный белок"
      ["description"]=>
      NULL
      ["values"]=>
      array(1) {
        [0]=>
        object(stdClass)#1652 (7) {
          ["id"]=>
          string(4) "1181"
          ["feature_id"]=>
          string(3) "399"
          ["position"]=>
          string(4) "1181"
          ["to_index"]=>
          string(1) "0"
          ["external_id"]=>
          NULL
          ["value"]=>
          string(216) "Эффективно защищает кожу, сохраняет ее увлажненной и уменьшает аллергические инфекции, такие как сыпь и темные пятна."
          ["translit"]=>
          string(141) "effektivnospzaschischaetspkozhucspsohranyaetspeespuvlazhnennojspispumenshaetspallergicheskiespinfektsiicsptakiespkakspsypspisptemnyesppyatnad"
        }
      }
      ["stingify_values"]=>
      string(216) "Эффективно защищает кожу, сохраняет ее увлажненной и уменьшает аллергические инфекции, такие как сыпь и темные пятна."
    }
    
                                        
    Эффективно защищает кожу, сохраняет ее увлажненной и уменьшает аллергические инфекции, такие как сыпь и темные пятна.
Отзывы
Сортировать по:
Пока нет комментариев
Характеристики
Отзывы

Отзывы

Применение
Клинические результаты
Помощь в выборе Виофтанов
Помощь в выборе Виоргонов
Вопросы
100% гарантия качества
100% гарантия качества
14 дней на возврат товара
(на условиях Закона Прав потребителя)
14 дней на возврат товара (на условиях Закона Прав потребителя)
Доставка по всей стране
Доставка по всей стране
Самовывоз (по договорённости)
Самовывоз (по договорённости)